PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_21500V3.5.p
Common NamePHYPADRAFT_233852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 2547aa    MW: 271238 Da    PI: 6.2411
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_21500V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.7e-0811031146347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                           WT  E el+ ++v+++G++ +++Ia ++g +++  qck ++ k 
  Pp3c12_21500V3.5.p 1103 QWTDRERELFTEGVRLFGKD-FERIAVHVGSTKSVGQCKAFFCKT 1146
                          5*****************99.*********99********99886 PP

2Myb_DNA-binding33.97.2e-1116281669346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                          +WT+eE e+++d ++ +G++ W++  ++++  ++l q+k ++q+
  Pp3c12_21500V3.5.p 1628 SWTQEEKEKFADIIRNHGKD-WTRLHECLP-SKSLTQIKTYFQN 1669
                          7*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.9E-13840903IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-4849896IPR009057Homeodomain-like
PROSITE profilePS5129317.276852903IPR017884SANT domain
SMARTSM007172.1E-7853901IPR001005SANT/Myb domain
PROSITE profilePS5129317.61710991151IPR017884SANT domain
SMARTSM007171.1E-811001149IPR001005SANT/Myb domain
SuperFamilySSF466892.47E-911031153IPR009057Homeodomain-like
PfamPF002499.1E-711031145IPR001005SANT/Myb domain
CDDcd001671.48E-511041145No hitNo description
SuperFamilySSF466892.9E-1016231673IPR009057Homeodomain-like
PROSITE profilePS512938.54216241675IPR017884SANT domain
SMARTSM007177.1E-916251673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-716261670IPR009057Homeodomain-like
CDDcd001672.29E-616281671No hitNo description
PfamPF002493.3E-816281669IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 2547 aa     Download sequence    Send to blast
MYSPGRGDAR ATALPNARDS STSMPIDHAS AWHREPYNRD ARLDRGDRER IIGGKREWNS  60
DRASFGAPYP RAFGGLHPVN GSLGPPNKRR LNGRHTGFHN EGGRYVSPGH RGEPPFGSVG  120
PVENGLGRKF DRESFYPGSG CPVGGSGFGN GVGVDQRAKE LEERHKKEPF LLLRDGRDGG  180
SCGGIEHGVR SFPSQAVCEA EKSCWERERS KGAVGNGWES SQKLQRDLRE RVGGKAEGYS  240
RREGKLSQHD GGREWSQADK ELEGRRVDGY GSSSRDGLTG DGVGGIKEAV GGCEWRRKER  300
SSSVSASRSG SYVASSGTAK GPVGRPQALD VSGSASSPQV SPHSTASPGV QEASRDDGSQ  360
PSPPKRPRLG WGQGLAKYEK KKVVETDEVG VSASGGSVSG RERSSVSGAT TEVVQTQESQ  420
AAEESPVSVV SNLSTLPPLT PSASPSQQAA EVVSKAMVEC DGVEQEVVGK VCERVAAEAE  480
AGGWISKPEG VVADDVEKRV EDGIDDGEAM DVDAAEVHPG RVDSRESGEA MQVACSGRNW  540
SGGEECGNGR WGSDGAGAAG NVGERVGGGV SEGGHGGSVD DGGVLEEGEL GEEKQEEWTS  600
KQMSVGLESE GNPAYSPRAE TEPAQREEMD VTAGVSKCGV AEKEEAERKV ISWDVEVVAR  660
SLMEENKKRA EQARETFVHL LREGVGVEGT LYRCPAEAGV WKENVERHYR NQERMLEKMG  720
ERRQSLRFAE QVLAMRFRAL KEAWKQEQVG MRQQQRGTKP VRRWEVEKRN GTALHCHRSS  780
LRLRPVQAGM EKVEAVSEEC MKKVMAKAVV GPVRGVLKMP SMIVGQENRL ARRFESKNAL  840
VEDPVGMERE RKSMNPWSWE EKRVFLEKFA VYNKNFSKIA SHLELKTTAD CVEFYYRNQK  900
SEDFERIRRR QQLKKRRDYS RVGGSFLSTG LQTSSQRREA NGHGRTEGAN VQTVGAVVGV  960
SHISVGTKAA RSSMQQKPVE RQRVSSALEP GSLPGAVEIG KGVSGKENKW CGTGGVSGSA  1020
AGRGGIFGMV LSGATVSCGL SSAVAGAVKI GRERSSVKTM VDAGLVVARC GQYEPNCFGA  1080
KGTRSIHPPL GLENFAKEEG DAQWTDRERE LFTEGVRLFG KDFERIAVHV GSTKSVGQCK  1140
AFFCKTRKRL GLDKLVEKYE DSLKVRYGGV MAESLECADV GRGEAAGMVA EDLRTSSLFE  1200
CSCPGMEVES HGDKGDENEK SVEAVVPVDV QEMEAVEVEA VEGVRVEGVV VEVQSVESEV  1260
VQDVAIADDA LVNGDVEPRG IEGFVAEDDA SQELMSKDEA IEKSVEDTGF EIAVVVASAA  1320
DADVDKASSN ASVEVTAFNE ALRDETVEDA AVEQVVVSEC LDAAAGILEN ENLAVEGSIV  1380
LEQVGTDGHP DEGRGVGGVA VETSNGVCEE GNGDAVGATS VVVISKDVLL GSFVCLKEDT  1440
AIVDSACPAD REPVASTPAV DASGAEDPVC VRTDAVNVPN DASVEAVKVD AAEDVFTGNK  1500
STDLAAGCTI REGDPADVVK VAESGLESSK CVAAVGVDKA VFPVTKMSTQ VADEPEAKAS  1560
PKVDVKSEPG SPQVATSVST DSASFTSAAA AVSHSGEPVF STTSSMQGRE KVGRVGGGET  1620
KSRREPTSWT QEEKEKFADI IRNHGKDWTR LHECLPSKSL TQIKTYFQNS KAKLGLLNAE  1680
GVNVPGGRVA GSRKRKVDEA ENGSNNVSCL SSGNELKGGG VSASDMDGVC QNVKAAVGGV  1740
PSMNPSMGMG SGPSGLESML YPFLGQRVED QIALQNFVRM YSANGLAQNI AGGVNPFVQQ  1800
YGFPMFPNAG HQRASQLSLQ QQLAASLAQK SGQAKGLQQQ ELQGFGSVQQ SGQASVQQKV  1860
AHQLQSAQMV RNQQLLASVM QHQAAAHHQQ NQTSKSVPHP LQPQVVVPQP GVAGQRQQHP  1920
QAQQGGSQQE QGSPGHPIGN PSLGVGNPTQ ASTQTKQLQQ PQVSLHQQQT LQQLQHQQHQ  1980
FLLQQHDHDH VRAQSHPQSH FHIQQPQNSH ASIVQPLIVQ KPKGVVPLQP QVTKPPLGTV  2040
AHQRCMPYRH DQQQLGPALS LLSGNGDSGL SNIRGEISNQ HGEIGDHRSC ISNGGASKGC  2100
DFSRADFHQL SASVQRVKPS HAAIPHRPSP TPAAVSAQGR PGDVKLFGQS LLSQPTSCAV  2160
SQSAARELVS AADRGSLQQS PASTAASSSL TSMPVSAASA TKSHGKESAF RGVSFMPDGL  2220
QGGRSSRGNQ GSLELWNNMS DVRSQAGPVS KSIDGDSDIR SMQECRMSRE AQDVESDPST  2280
LKLTHKLQHL DQARGVQEHS GSEGFSPVVH GVGKARACAN EHGVGVGFAV SCGEVSRTDP  2340
ERRGESIGID LGCSERSSIM ASRSNRGQVE SFAMQAAGLL ANGPQVHRNL IDYLMAITEL  2400
HQTRSLSSHS SVGQPRLEDH QWESLTRHPT NGTAVDALKV NPTLGLGSPI AAPQTHLSGN  2460
DLFQQCVRDS SMYFSQHYPS LAGHGVSSSA WNGGAGLVHP SEMQRVLVNP PLSSFLPGVF  2520
SRAPVTEDHL GSTETRDPER GGGGIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-15811905194NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-15811905194NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.109160.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769009.10.0predicted protein
TrEMBLA9SRK80.0A9SRK8_PHYPA; Predicted protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-34MYB family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]